PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Rsa1.0_00197.1_g00014.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; malvids; Brassicales; Brassicaceae; Brassiceae; Raphanus
Family MYB
Protein Properties Length: 351aa    MW: 39091.6 Da    PI: 8.5767
Description MYB family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Rsa1.0_00197.1_g00014.1genomeRGDView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Myb_DNA-binding551.9e-171461148
                             TSSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHHHT CS
          Myb_DNA-binding  1 rgrWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqkyl 48
                             +g W++eEde+l++ ++ +G g+W+++++  g+ R++k+c++rw +yl
  Rsa1.0_00197.1_g00014.1 14 KGLWSPEEDEKLLKHITNHGHGCWSSVPKLAGLQRCGKSCRLRWINYL 61
                             678*******************************************97 PP

2Myb_DNA-binding47.64e-1567109145
                              TSSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHH CS
          Myb_DNA-binding   1 rgrWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwq 45 
                              rg++++eE+ l+v+++  lG++ W+ Ia++++ gRt++++k+ w+
  Rsa1.0_00197.1_g00014.1  67 RGAFSPEEENLIVELHSVLGNR-WSQIAARLP-GRTDNEIKNLWN 109
                              89********************.*********.*********998 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
Gene3DG3DSA:1.10.10.603.7E-27664IPR009057Homeodomain-like
PROSITE profilePS5129418.232961IPR017930Myb domain
SuperFamilySSF466894.87E-2912108IPR009057Homeodomain-like
SMARTSM007172.9E-121363IPR001005SANT/Myb domain
PfamPF002493.6E-151461IPR001005SANT/Myb domain
CDDcd001671.82E-111761No hitNo description
PROSITE profilePS5129424.97762116IPR017930Myb domain
Gene3DG3DSA:1.10.10.601.9E-2565117IPR009057Homeodomain-like
SMARTSM007173.6E-1366114IPR001005SANT/Myb domain
PfamPF002497.2E-1467109IPR001005SANT/Myb domain
CDDcd001672.84E-1069109No hitNo description
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 351 aa     Download sequence    Send to blast
MGRHSCCYKQ KLRKGLWSPE EDEKLLKHIT NHGHGCWSSV PKLAGLQRCG KSCRLRWINY  60
LRPDLKRGAF SPEEENLIVE LHSVLGNRWS QIAARLPGRT DNEIKNLWNS SIKKKLKQRG  120
IDPNTHKPIS EVESFSDKDK PKTTSNNNHK SPSSSSATNQ DFFLDKPSDF SDYFGFQKLN  180
FNSNLGLSVT PDSSPLCSMI PAQFSPGNMV GSVFQTPVSV KPSISLAPDN SSSSVSVGDH  240
VFPANNTSNF FDNGGFSWSV PNSSSSSLVK PNHNLEEMKW SEYSMNSPFF NGSAQNSQPI  300
YIKSEAEYLA NVSNMADPWS QRQNENLATP EASDVFSKDL QRMAVSFGQS L
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
1a5j_A1e-28121165108B-MYB
Search in ModeBase
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankKC9667410.0KC966741.1 Brassica napus MYB transcription factor 61 (MYB61.1) mRNA, complete cds.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_006417564.10.0hypothetical protein EUTSA_v10008000mg
TrEMBLV4L0S40.0V4L0S4_EUTSA; Uncharacterized protein
STRINGscaffold_100991.10.0(Arabidopsis lyrata)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MalvidsOGEM4282646
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT1G09540.10.0myb domain protein 61